General Information

  • ID:  hor006944
  • Uniprot ID:  P13232??27-177)
  • Protein name:  Interleukin-7
  • Gene name:  LHB
  • Organism:  Homo sapiens
  • Family:  IL-7/IL-9 family.
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0005125 cytokine activity; GO:0008083 growth factor activity; GO:0005139 interleukin-7 receptor binding
  • GO CC:  GO:0007267 cell-cell signaling; GO:0045453 bone resorption; GO:0042100 B cell proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0009887 animal organ morphogenesis; GO:0046622 positive regulation of organ growth; GO:0006959 humoral immune response; GO:0045582 positive regulation of T cell differentiation; GO:0050730 regulation of peptidyl-tyrosine phosphorylation; GO:0002360 T cell lineage commitment; GO:0001961 positive regulation of cytokine-mediated signaling pathway; GO:0097191 extrinsic apoptotic signaling pathway; GO:0048873 homeostasis of number of cells within a tissue; GO:0019221 cytokine-mediated signaling pathway; GO:0032722 positive regulation of chemokine production; GO:0030890 positive regulation of B cell proliferation; GO:2001240 negative regulation of extrinsic apoptotic signaling pathway in absence of ligand; GO:0038111 interleukin-7-mediated signaling pathway; GO:0043066 negative regulation of apoptotic process; GO:0045579 positive reg

Sequence Information

  • Sequence:  CDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
  • Length:  151
  • Propeptide:  MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
  • Signal peptide:  MFHVSFRYIFGLPPLILVLLPVASS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA